PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G027300.5.p
Common NameSb09g002290, SORBIDRAFT_09g002290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB_related
Protein Properties Length: 1563aa    MW: 169160 Da    PI: 5.3959
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G027300.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding271.1e-08657699347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           +WT+eE e++ +  +++G++ +++I+  +  ++t  +c+++++k+
  Sobic.009G027300.5.p 657 PWTQEEKEIFMEMLAKFGKD-FSKISCFIT-HKTTADCVEFYYKH 699
                           8*****************99.********9.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-14641702IPR009057Homeodomain-like
PROSITE profilePS5129314.706653704IPR017884SANT domain
SMARTSM007173.7E-8654702IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-6655701IPR009057Homeodomain-like
PfamPF002491.1E-6656699IPR001005SANT/Myb domain
PROSITE profilePS5129312.6863914IPR017884SANT domain
SMARTSM007174.5E-6864912IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-9867914IPR009057Homeodomain-like
CDDcd001671.73E-4868906No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1563 aa     Download sequence    Send to blast
MRGSYRRSPY RGGYGSDFSR NHPEQPPPPP PRRSPLRSVA VPICYDPPGN RVDRGDRDNL  60
PRVTPWRRRE SRSEAADAVG QTTRLSASGK EASAQPLAVA GPHGTEDEAP RKKARLGWGQ  120
GLAKYEKQKV QGPVDPAEAV ADGSPADGEQ KTASLAPAPT PTPVPSVAPV PPAAPVPDPV  180
PAPAPPAPPA APVLLSAPVG CSSPVTAPPY CSSAPEDKSC EMMPNTVTNS TKDVLEADDK  240
TFNNEFSIKL DQLGDDPVSS LANMLVELIQ HDDSCSGDSN GPTSTCKLLL LKENISKEIE  300
KTELEIDSLE GELKSVNTEA LTTLEGSPTG VPHTENLSPS SGTSKVPGSV EICDTSDMIR  360
EPGELIGSPK VPVVQDADVK GADMMEIEAA PVHNAKTVPS EESAVSPGVA EGKACAAADL  420
SSLKASEEAG SQNDIDNDRL ETSSCHANAD SMEIELSDDH KSDLLSSVTS ANNDIAKEMN  480
EVLFKSLPGD TPDLEMLASS HLLSQRKSDL IVKERLGVRK TRLRLKEQIL TMKFKAYRHL  540
WKEDVRLLSA KKQRSKSNKR IDQSNRTSQI GSQRQRSSNR SRLAMPAGNL STFSTPEMSD  600
VARKLFSEFQ IKRCRNYLKM PALIIDEKEK ECSRFLSKNG LVEDPVLVEK ERVMINPWTQ  660
EEKEIFMEML AKFGKDFSKI SCFITHKTTA DCVEFYYKHH KSDSFREVKK LLDLRQQQPT  720
SNYLGAKSGQ KWNPESNAAS LDMLGAASVV AAHGLEYANR VEKISAKSLI RTSYGPNVPF  780
VSKKSSDKEC IDNVPLHERE SVAADVLAGI CGTLSPDGMG SCITSSADPG QKISMKRVEH  840
VLSQENDKIV DEEDTLSDQE CEVDPVDWND DEKSIFIEAM NNYGKDFARI SSCVKSKSYE  900
QCKVFFSKAR KSLGLDLIHQ GAADVSMPAS DTNGGRSDTD EACAVEMDSA ICSTQSCSKI  960
VIDVCPTEGA IGGPNSVIIS KQAGEISNGC DVDAKIEEDE EEADKNCSIV DDKRSSDGTH  1020
QAVPIDINCP ESTDKLQGTD DVVDQVNVHS SSAISSTTKH TMAMHSEVRS SLHSIEVLQT  1080
DKAEGTGTDP SQVEECSHHA LDNTPMKTGN SGASDSGIKD NVHILNMTGT STVSPAFTSS  1140
YQHSVPGDMP LLKPKPLVTP LTPKDLMPVQ FSSVLPDPTA FRFEGIASIT TPNFEDSGNR  1200
VSSALGAKDM SKYPAFKDPS GNQHDTLFRN IDGYVNHRLT TELPIFSERT ASGNVSTSQT  1260
DRFNQTKFQN GRSSSLCLPN SSDGIQWSRK HEEIQEGSLR PCSRNTSSEG DEQQKRPGDV  1320
KLFGQILSQP STLQSSGSLC NGSKSKPPSP KIDTSSVRLM NNPRDRVVCS SRPGITPHLG  1380
LEERSARSYG HLDGSTTQPE PLLVMAKCQR SLAGVPFYSA KNGTLGVFPD YQQPLVPPHQ  1440
SDPKRQERFS DPQKRNGLEL ISGFQQPGRV ARFGGAGILV SNVSDPVAAA IKAQYGPGSK  1500
IMGSDADPWK DIGSSSIPFG SLTCQQWHND SAVGSLEMTR YLSAGFDFVS FMQKTSQVFV  1560
IW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C6e-14615706494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D6e-14615706494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1550556KKQRSKS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.116340.0leaf| ovary
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9431480.0EU943148.1 Zea mays clone 1570595 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440514.10.0hypothetical protein SORBIDRAFT_09g002290
TrEMBLC5YZ470.0C5YZ47_SORBI; Putative uncharacterized protein Sb09g002290
STRINGSb09g002290.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-91MYB family protein